PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Whirly
Protein Properties Length: 303aa    MW: 34111 Da    PI: 9.5539
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S41652664PU_refUnigeneView CDS
PUT-183a-Picea_sitchensis-17914PU_unrefplantGDBView CDS
PUT-183a-Picea_sitchensis-17913PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly164.72.5e-511252622139
     Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpd 101
                vyk+ +al++k+++p++ +l+ g +++ ++G ++le+a+a+++r+ydW+kk+  als+ ev++l++l++ escef hdp++++s++Gk+ k+lkv  l d
  Psi000440 125 VYKGEGALTMKPKLPDYITLNMGGVTVAKEGCMFLEFAPAVGPRQYDWSKKKIIALSVVEVGTLLSLGPDESCEFTHDPFMGKSEAGKIMKVLKVGNLQD 224
                9*************************************************************************************************** PP

     Whirly 102 GsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                  G+f+nlsvt  +  ++esfs+P++k+ef+v++s+++
  Psi000440 225 TGGYFFNLSVTDRIADVDESFSIPITKGEFSVMQSIFN 262
                ***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.4E-73113284IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.14E-59117292IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.0E-51125260IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
XEVWRQAELK TPHTDNLRLL LSPEVWRQAE LKTPHTDNLQ PQQKKKMLRL KVLGARILGG  60
SATRRFQPLC MPFSSSHWYS KVAKASSNDE LSEVRGLSSS LDHYALTQPE FLRRQTNKIY  120
VKHTVYKGEG ALTMKPKLPD YITLNMGGVT VAKEGCMFLE FAPAVGPRQY DWSKKKIIAL  180
SVVEVGTLLS LGPDESCEFT HDPFMGKSEA GKIMKVLKVG NLQDTGGYFF NLSVTDRIAD  240
VDESFSIPIT KGEFSVMQSI FNFILPYLMG WHAYMDSTKL NESGHFKSGG PSIAKRPDLE  300
WGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_A4e-681182798169Single-stranded DNA-binding protein WHY1, chl
4koo_B4e-681182798169Single-stranded DNA-binding protein WHY1, chl
4koo_C4e-681182798169Single-stranded DNA-binding protein WHY1, chl
4koo_D4e-681182798169Single-stranded DNA-binding protein WHY1, chl
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.48810.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256524.12e-71PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotQ9M9S32e-71WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA9NLD10.0A9NLD1_PICSI; Putative uncharacterized protein
STRINGAT1G14410.16e-69(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-72ssDNA-binding transcriptional regulator